App Profile: AI Calorie Tracking: CalSynPro

Android / Games / Puzzles
AI Calorie Tracking: CalSynPro
Installs:
Rating:
4.45
Total Reviews:
94
Top Countries:
FR, NL, DE
< $5k
/mo
< 5k
/mo
Reviews: What People Think About AI Calorie Tracking: CalSynPro
sharaf salih
Rating: 5/5
Recommended app for gym lovers to gain or lose weight
emerence
Rating: 1/5
Supposedly there is a lifetime option and it’s supposed to be free atm. The button is not there and there is no way I’m spending so much on something I haven’t tried and a 7 day free trial on an app like this isn’t worth beans. I’m disappointed. I did want to try it but if I am going to have to pay for it to try it for longer than 7 days. That’s not enough time to determine squat. Especially since it’s setting up just a month weight loss plan anyway. It would take a month to know if it will even have a good chance of working for you.
Soitsme
Rating: 2/5
Got this recently. The app doesn’t seem to fit properly on my phone. It’s awkward and clumsy to use. It’s could probably work around that but it doesn’t have a way to configure it for specific diets. For example vegetarian. It offer way too many meat options. 2 Star and will likely delete.
About AI Calorie Tracking: CalSynPro
CalSync Pro – Smart Nutrition, Effortless Tracking, 2X Wellness Boost!
Take charge of your health, nutrition, and fitness goals—without the hassle! CalSync Pro is your AI-powered meal planner, calorie counter, and macro tracker all in one. Whether you're looking to lose weight, build muscle, or simply eat better, our smart tools make it easy, fast, and stress-free.
Smarter Eating, Faster Results
No more second-guessing your meals! Our AI-powered meal planner curates meals that match your lifestyle, dietary needs, and goals—so you can focus on enjoying delicious, nutritious food without the planning headache.
How it works:
1. Set your goals: weight loss, muscle gain, or balanced nutrition
2. Log your meals effortlessly with AI-powered tracking
3. Get instant calorie and macro breakdowns for each meal
4. Organize your grocery list with meal plan integration
5. Stay on track with real-time progress insights
FEATURES:
● Effortless Calorie & Macro Tracking – Instantly track calories, carbs, protein, and fat with our intuitive macro breakdown.
● AI Food Scanner & Massive Food Library – Snap, scan, and log your meals in seconds or explore our extensive food database for easy tracking.
● Custom Meal Planning & Grocery List Integration – Plan daily, weekly, or monthly meals and turn them into a ready-to-go grocery list—so meal prep is smooth and stress-free.
● Real-Time Progress Tracking – Stay motivated with interactive charts and insights that help you visualize your progress at a glance.
● Tasty, Healthy Recipes – Discover simple, nutritious meals that align with your goals and make healthy eating exciting!
Built for Your Goals, Designed for Your Lifestyle
Whether you're a busy professional, fitness enthusiast, or just starting your health journey, CalSync Pro adapts to you. No more confusion—just simple, smart nutrition made easy.
Build the body you want, one meal at a time.
Download CalSync Pro today and unlock a simpler, healthier way to eat, track, and thrive!
Be a part of our community :
IG : @calsyncpro
X : @calsync_pro
TK : @calsyncproapp
Terms of service: https://www.appsallset.com/terms-conditions
Privacy policy: https://www.appsallset.com/privacy-policy
Subscription pricing and terms :
● Your subscription lasts 1 week, 1 month, 3 months , or 12 months
● Payment will be charged to your iTunes Account at confirmation of purchase.
● Your subscription automatically renews unless auto-renewal is turned off at least 24 hours before the end of the current subscription.
● Your account will be charged for a renewed subscription within 24 hours prior to the end of the current subscription.
● You can manage your subscription and switch off the auto-renewal by accessing your Apple ID setting after purchase.
● Your iTunes Account will be charged when the purchase is confirmed. If you subscribe before your free trial ends, the rest of your free trial period will be forfeited as soon as your purchase is confirmed.
Take charge of your health, nutrition, and fitness goals—without the hassle! CalSync Pro is your AI-powered meal planner, calorie counter, and macro tracker all in one. Whether you're looking to lose weight, build muscle, or simply eat better, our smart tools make it easy, fast, and stress-free.
Smarter Eating, Faster Results
No more second-guessing your meals! Our AI-powered meal planner curates meals that match your lifestyle, dietary needs, and goals—so you can focus on enjoying delicious, nutritious food without the planning headache.
How it works:
1. Set your goals: weight loss, muscle gain, or balanced nutrition
2. Log your meals effortlessly with AI-powered tracking
3. Get instant calorie and macro breakdowns for each meal
4. Organize your grocery list with meal plan integration
5. Stay on track with real-time progress insights
FEATURES:
● Effortless Calorie & Macro Tracking – Instantly track calories, carbs, protein, and fat with our intuitive macro breakdown.
● AI Food Scanner & Massive Food Library – Snap, scan, and log your meals in seconds or explore our extensive food database for easy tracking.
● Custom Meal Planning & Grocery List Integration – Plan daily, weekly, or monthly meals and turn them into a ready-to-go grocery list—so meal prep is smooth and stress-free.
● Real-Time Progress Tracking – Stay motivated with interactive charts and insights that help you visualize your progress at a glance.
● Tasty, Healthy Recipes – Discover simple, nutritious meals that align with your goals and make healthy eating exciting!
Built for Your Goals, Designed for Your Lifestyle
Whether you're a busy professional, fitness enthusiast, or just starting your health journey, CalSync Pro adapts to you. No more confusion—just simple, smart nutrition made easy.
Build the body you want, one meal at a time.
Download CalSync Pro today and unlock a simpler, healthier way to eat, track, and thrive!
Be a part of our community :
IG : @calsyncpro
X : @calsync_pro
TK : @calsyncproapp
Terms of service: https://www.appsallset.com/terms-conditions
Privacy policy: https://www.appsallset.com/privacy-policy
Subscription pricing and terms :
● Your subscription lasts 1 week, 1 month, 3 months , or 12 months
● Payment will be charged to your iTunes Account at confirmation of purchase.
● Your subscription automatically renews unless auto-renewal is turned off at least 24 hours before the end of the current subscription.
● Your account will be charged for a renewed subscription within 24 hours prior to the end of the current subscription.
● You can manage your subscription and switch off the auto-renewal by accessing your Apple ID setting after purchase.
● Your iTunes Account will be charged when the purchase is confirmed. If you subscribe before your free trial ends, the rest of your free trial period will be forfeited as soon as your purchase is confirmed.
File size: 210022400
Launched countries: RUBYBGCYECINLTMTRSSKSITWLVMAEGILMYPKPHLKVN
Minimum OS version: 17.0
Release Date: 1729321200000
Published by Nutnicha Paladsang
Website url: https://www.appsallset.com
Publisher country: