App Profile: INSIGHT KIDNEY

Android / Games / Puzzles
INSIGHT KIDNEY
Installs:
Rating:
4.87
Total Reviews:
15
Top Countries:
DE, BR, US
< $5k
/mo
< 5k
/mo
Reviews: What People Think About INSIGHT KIDNEY
RoadWarrior2004
Rating: 3/5
I have been using insight lung an heart, which are very useful for patients to visually understand damage by disease. CKD portion leaves much to be desired, as the app does not show diseased glomerulus progressing from healthy to CKD1-5. Presently, the healthy glomerulus does not look any different from CKD, which is of little utility for helping patients understand the gravity of disease and importance of therapy. I hope to see the app more developed like the insight heart and lung. I wonder if the developers can provide visuals for drug effects to help patients understand how drug therapy functionally impacts their lungs, heart and kidneys. Excellent concept though, especially with developers making it accessible without cost.
About INSIGHT KIDNEY
INSIGHT KIDNEY - The human kidney expedition

- Nominated for the ‘German Medical Award’ 2023
- Nominated for the ‘German Design Award’ 2023


Having an illness is already very difficult to bear. Not understanding an illness and not knowing what is happening to your own body makes it even more difficult and unbearable.

As a person affected, as a relative or as a person with a thirst for knowledge, one searches the Internet for information. Immunoglobulin A nephropathy (IgAN), C3 glomerulopathy (C3G), atypical hemolytic uremic syndrome (aHUS) and lupus nephritis (LN) are diseases that affect the organ system kidney.

Young people between the ages of 20 and 40 are affected. The median age for C3G is 26 years. Therefore, adolescents or even children are also affected.

C3G was found to affect fewer than 4,000 patients in 2017. aHUS affects fewer than 2,000 people, for example, in the United States.

Explore the human kidney in augmented reality and learn more about CKD, aHUS, IgAN, C3G and LN.

Using ARKit, INSIGHT KIDNEY allows users to easily scan their physical environment and place the three-dimensional kidney. Our virtual assistant ANI guides you through the different states of the kidney.

Embark on a journey through the kidney, from macroscopic to microscopic anatomy, and explore the structures of the kidney in unprecedented detail.

INSIGHT KIDNEY has visualized pathological changes in addition to anatomically correct representations.

Trigger impressive visualizations of the healthy kidney, CKD, aHUS, IgAN, C3G and LN and get an idea of their condition and severity.

Due to their rarity, there is a tremendous need for tangible information about these rare kidney diseases.

Here, for the first time, Insight Kidney attempts to visualize these rare kidney diseases with anatomically correct 3D representations to fill the knowledge gap for patients.



The 'Insight Apps' won the following awards:

INSIGHT LUNG - The human lung expedition
- Winner of the 'German Medical Award 2021'
- Platinum at the 'Muse Creative Awards 2021'
- Gold at the 'Best Mobile App Awards 2021'


INSIGHT HEART - The human heart expedition
- Platinum at the 2021 MUSE Creative Awards
- German Design Award Winner 2019 – Excellent Communications Design
- Apple Keynote 2017 (Demo Area) – USA / Cupertino, Sept 12
- Apple, BEST OF 2017 – Tech & Innovation, Australia
- Apple, BEST OF 2017 – Tech & Innovation, New Zealand
- Apple, BEST OF 2017 – Tech & Innovation, USA
File size: 837937152
Launched countries: DZKEAZHRCYCZGHILNZNGNOOMPKPAPETWUAVEEEAUCNDEGBITJPKRRUAOARATBHBBBEBGCODKDOEGGRGTHKHUKZLBLTLUMOMGMYMTQAROSARSSILKTNUZVNBOLVIQMAUSCAFRBYBMCLECFIINIDIESKAEGEMMCRSVKWNLPHPTESSEKHYENIMXPLSGZACHTHTRUYPYLYMZAFBRBJBFCMCGCIJOLAMLSNTZUGZMZW
Minimum OS version: 12.0
Release Date: 1652943600000
Published by ANIMA RES
Website url: https://www.animares.com
Publisher country: Germany
Copyright © 2025. Made with ♥ in London by AdScan.ai